PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G20400.1
Common NameF11A3.5, PHL4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 397aa    MW: 44112.2 Da    PI: 4.4822
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G20400.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32231285155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k r+rWtpeLHe Fv+av+qLGGs++AtPk +l++mkv+gLt+ hvkSHLQkYR+
  AT2G20400.1 231 KGRMRWTPELHEVFVDAVNQLGGSNEATPKGVLKHMKVEGLTIFHVKSHLQKYRT 285
                  56****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.866228288IPR017930Myb domain
SuperFamilySSF466891.97E-17230285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-29230286IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-24231286IPR006447Myb domain, plants
PfamPF002491.3E-9233284IPR001005SANT/Myb domain
PfamPF143799.4E-16317361IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MIPNDDDDAN SMKNYPLNDD DANSMKNYPL NDDDANSMEN YPLRSIPTEL SHTCSLIPPS  60
LPNPSEAAAD MSFNSELNQI MARPCDMLPA NGGAVGHNPF LEPGFNCPET TDWIPSPLPH  120
IYFPSGSPNL IMEDGVIDEI HKQSDLPLWY DDLITTDEDP LMSSILGDLL LDTNFNSASK  180
VQQPSMQSQI QQPQAVLQQP SSCVELRPLD RTVSSNSNNN SNSNNAAAAA KGRMRWTPEL  240
HEVFVDAVNQ LGGSNEATPK GVLKHMKVEG LTIFHVKSHL QKYRTAKYIP VPSEGSPEAR  300
LTPLEQITSD DTKRGIDITE TLRIQMEHQK KLHEQLESLR TMQLRIEEQG KALLMMIEKQ  360
NMGFGGPEQG EKTSAKTPEN GSEESESPRP KRPRNEE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.438670.0bud
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306809790.0
Genevisible265316_at0.0
Expression AtlasAT2G20400-
AtGenExpressAT2G20400-
ATTED-IIAT2G20400-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in male gametophyte development. {ECO:0000269|PubMed:22101548}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00111ampDAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G20400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Separated male germ unit (MGU) with all nuclei separated from each other making a wide triangular figure. {ECO:0000269|PubMed:22101548}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G20400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1183130.0AK118313.1 Arabidopsis thaliana At2g20400 mRNA for unknown protein, complete cds, clone: RAFL19-59-J02.
GenBankBT0061190.0BT006119.1 Arabidopsis thaliana clone U50843 unknown protein (At2g20400) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179630.20.0myb-like HTH transcriptional regulator-like protein
TrEMBLQ8GXC20.0Q8GXC2_ARATH; Myb-like HTH transcriptional regulator-like protein
STRINGAT2G20400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Reňák D,Dupl'áková N,Honys D
    Wide-scale screening of T-DNA lines for transcription factor genes affecting male gametophyte development in Arabidopsis.
    Sex. Plant Reprod., 2012. 25(1): p. 39-60
    [PMID:22101548]